Powelliphanta

Genus of gastropods


title: "Powelliphanta" type: doc version: 1 created: 2026-02-28 author: "Wikipedia contributors" status: active scope: public tags: ["powelliphanta", "rhytididae", "endemic-fauna-of-new-zealand", "endemic-molluscs-of-new-zealand"] description: "Genus of gastropods" topic_path: "geography/new-zealand" source: "https://en.wikipedia.org/wiki/Powelliphanta" license: "CC BY-SA 4.0" wikipedia_page_id: 0 wikipedia_revision_id: 0

::summary Genus of gastropods ::

| image = Powelliphanta hochstetteri bicolor shell.jpg | image_caption = Shell of Powelliphanta hochstetteri bicolor | taxon = Powelliphanta | authority = O'Connor, 1945O'Connor A. C. (1945). "Notes on the Eggs of New Zealand Paryphantidae, With Description of a New Subgenus." Transactions of the Royal Society of New Zealand 5: 54–57. | subdivision_ranks = Species | subdivision = See text.

Powelliphanta is a genus of large, air-breathing land snails, pulmonate gastropods in the family Rhytididae, found only in New Zealand. They are carnivorous, eating invertebrates, mostly native earthworms. Often restricted to very small areas of moist forest, they are prey to introduced mammalian predators, and many species are threatened or endangered.

Taxonomy

Powelliphanta was originally described by A. C. O'Connor in 1945 as a subgenus of the kauri snails, Paryphanta. They were named "in recognition of the great service rendered to the study of the family by Mr A. W. B. Powell", and from their similarity to Paryphanta. ::figure[src="https://upload.wikimedia.org/wikipedia/commons/4/4a/Powelliphanta_lignaria_johnstoni_DOC_2003.jpg" caption="''[[Powelliphanta lignaria johnstoni]]'', [[Mōkihinui River"] ::

|left|300x300px]] ::figure[src="https://upload.wikimedia.org/wikipedia/commons/b/b6/Powelliphanta_marchanti_DOC_1986.jpg" caption="''[[Powelliphanta marchanti]]''"] ::

::figure[src="https://upload.wikimedia.org/wikipedia/commons/0/0f/Powelliphanta_annectens_DOC_2007.jpg" caption="''[[Powelliphanta annectens]]''"] ::

::figure[src="https://upload.wikimedia.org/wikipedia/commons/d/dd/Powelliphanta_hochstetteri_hochstetteri_DOC_2009.jpg" caption="''[[Powelliphanta hochstetteri hochstetteri]]''"] ::

Sub-genus POWELLIPHANTA nov.

Shell generally, similar to Paryphanta Albers, but with the last whorl pulled in closer to the preceding whorl, and with a colour pattern of concentric or radially arranged bands, usually of alternating and contrasting colours. More important is the paucity of lime compared with conchin in the shell.

Egg always with cuticle, pale buff when laid.

Distribution: North Island of New Zealand, in and south of the Ruahine Range (possibly once as far north as East Cape) and South Island.

Type: Helix hochstetteri Pfeiffer, Mal. Bl., viii, 146, 1862 (see PI. 6, Figs. 5–8).

Powelliphanta will include all New Zealand species previously included in Paryphanta except the type of that genus, P. busbyi (Gray, 1840) which is confined to the North Auckland Peninsula.}}

In 1977 Climo raised Powelliphanta to genus rank, retaining just two species in Paryphanta. There are at least 21 species and 51 subspecies within the genus. The relationship between the species is complex, and it has been suggested that the group Powelliphanta gilliesi-traversi-hochstetteri-rossiana-lignaria-superba forms a ring species.

Distribution

Powelliphanta are endemic to New Zealand, ranging in the North Island from Lake Waikaremoana to the Kāpiti Coast, and in the South Island from the Marlborough Sounds to Fiordland and Southland. Their greatest diversity is in the mountains of northwest Nelson and north Westland. Some species have an extremely restricted distribution, such as Powelliphanta gilliesi brunnea, which is only found in a 1 ha remnant of coastal forest.

Habitat

These snails live mostly in moist native forest. Some live in lowland forest, such as P. traversi traversi, which is nationally endangered and has its own 10 ha reserve of kahikatea forest and raupo swamp near Levin. Other species live in upland forest, or even under tussock grasses above the treeline. Several species only inhabit forests on limestone soils; they require calcium to build their shells and eggs, and this is obtained from eating invertebrates (including other snails) which have taken up calcium from the limestone environment. Powelliphanta require a moist environment because, unlike other land snails, they cannot seal off their shells with a protective mucous membrane.

Description

::figure[src="https://upload.wikimedia.org/wikipedia/commons/3/39/Powelliphanta_traversi_traversi_Papaitonga.jpg" caption="''[[Powelliphanta traversi traversi]]'' at [[Lake Papaitonga"] ::

The largest species, Powelliphanta superba prouseorum, has a shell up to 9 cm across and can weigh 90 g. The striking delicately patterned shells of Powelliphanta come in an array of shades, from brown or red to yellow or black. The structure of these shells is very delicate, with a very thin layer of calcium carbonate, covered by a thicker chitinous outer layer. These snails need moist surroundings, otherwise the outer layer (periostracum) dries, shrinks and cracks; this sometimes happens in museum shells of this genus which have been stored dry.

Life habits

| align = | width = 185px | video1 = Snail Attack (Powelliphanta feeding)

Powelliphanta can live for 20 years or more, and are slow to mature, reaching sexual maturity around 5–6 years of age. They are hermaphrodites, having both male and female sex organs. They lay 5 to 10 large (bean-sized) eggs a year, which have a thin pink calcium carbonate shell, like a tiny bird's egg. Eggs take 2–6 months to hatch in lowland species, 12–14 months for high-altitude species.

Fossil record

Originating more than 235 million years on the supercontinent Gondwana, these snails have been isolated in New Zealand since it separated from Australia about 80 million years ago, and have evolved into numerous distinct species.

Conservation status

::figure[src="https://upload.wikimedia.org/wikipedia/commons/4/4c/Possum_predated_Powelliphanta_traversi_DOC_1994.jpg" caption="Possum]]-preyed ''[[Powelliphanta traversi]]'' snail shells."] ::

Most of these snails are under serious threat or even in danger of extinction. Their main natural predator is the weka, but they have no defences against introduced mammalian predators, such as brushtail possums (Trichosurus vulpecula), pigs, hedgehogs, and rats. Possums have been shown to eat up to 60 snails in one night. Habitat modification and trampling by introduced animals like goats, deer, and cows is also a threat.

Controlling predatory mammals is now critical to the survival of Powelliphanta, and many recovery plans are being undertaken by the Department of Conservation. After aerial application of 1080 poison, P. "Anatoki Range" numbers increased threefold at sites in Kahurangi National Park, with large numbers of juveniles present. Prior to applying 1080, there were 54 snails found on a 500 sq grid. One year after the 1080 drop, 147 snails were found on the same plot. Between 1994 and 2010, a series of three aerial 1080 operations over 3430 ha of the Ruahine Forest Park resulted in significant increases in Powelliphanta marchanti. The subspecies Powelliphanta gilliesi brunnea and Powelliphanta traversi otakia are the most threatened. The IUCN Red List states for Powelliphanta marchantii a lower risk, near threatened.

It is illegal since 1982 to collect shells of Powelliphanta; collecting live animals for their shells may have made some species rarer, but some species also need to feed on discarded shells to recycle their calcium lining.

Species

Species within the genus Powelliphanta include: ::data[format=table]

::

Cultural relevance

A Powelliphanta illustrated by Dave Gunson appeared on a New Zealand 40-cent postage stamp, issued October 1997.

References

This article incorporates public domain text from O'Connor (1945).

References

  1. Climo, F.M.. (1977). "A new higher level classification of the New Zealand Rhytididae (Mollusca: Pulmonata)". Journal of the Royal Society of New Zealand.
  2. "Powelliphanta snail". New Zealand Department of Conservation.
  3. Climo, F.M.. (1978). "The ''Powelliphanta gilliesi-traversi-hochstetteri-rossiana-lignaria-superba'' ring species (Mollusca: Pulmonata)". New Zealand Journal of Zoology.
  4. (2006). "New Zealand Land Snails". Department of Conservation.
  5. Hutching, Gerard. (1998). "The Natural World of New Zealand". Reader's Digest.
  6. Judd, Warren. (July–September 1990). "Slow, slimy and surprising!". New Zealand Geographic.
  7. Ryan, Paddy. (13 July 2012). "Snails and slugs – Flax snails, giant snails and veined slugs".
  8. Collett, Geoff. (19 September 2009). "It's so hard being a snail". Nelson Mail.
  9. (17 September 2003). "Hedgehogs pose prickly problem for native fauna". [[Landcare Research]] media release.
  10. (26 October 2010). "Giant snails the winners". New Zealand Department of Conservation.
  11. "Creepy Crawlies".

::callout[type=info title="Wikipedia Source"] This article was imported from Wikipedia and is available under the Creative Commons Attribution-ShareAlike 4.0 License. Content has been adapted to SurfDoc format. Original contributors can be found on the article history page. ::

powelliphantarhytididaeendemic-fauna-of-new-zealandendemic-molluscs-of-new-zealand